PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr030553.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 267aa    MW: 30049.4 Da    PI: 4.8601
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr030553.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.31.4e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l   ++++G g+W++ ++  g+ R++k+c++rw +yl
      Pbr030553.1 14 KGPWTSEEDQILTSFIQKYGHGNWRALPKQAGLLRCGKSCRLRWVNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding54.52.7e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T eE+e +v+++++lG++ W++Ia++++ gRt++++k+ w+++l
      Pbr030553.1  67 RGNFTREEEEAIVKLHEMLGNR-WSAIAARLP-GRTDNEIKNVWHTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-25564IPR009057Homeodomain-like
PROSITE profilePS5129415.054961IPR017930Myb domain
SuperFamilySSF466895.5E-3110108IPR009057Homeodomain-like
SMARTSM007171.3E-131363IPR001005SANT/Myb domain
PfamPF002494.4E-151461IPR001005SANT/Myb domain
CDDcd001672.39E-101661No hitNo description
PROSITE profilePS5129426.32962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2665116IPR009057Homeodomain-like
SMARTSM007172.4E-1566114IPR001005SANT/Myb domain
PfamPF002491.6E-1567112IPR001005SANT/Myb domain
CDDcd001674.70E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MGRAPCCEKM GLKKGPWTSE EDQILTSFIQ KYGHGNWRAL PKQAGLLRCG KSCRLRWVNY  60
LRPDIKRGNF TREEEEAIVK LHEMLGNRWS AIAARLPGRT DNEIKNVWHT HLKKRLKDHT  120
TTTSSTRSSS NSTSNVTSQF ADEPENLNYP QPSSSDVSSS VTEVSAALST DQDTIVVKGE  180
NMELSETFPD IDDSFWSEAL STDNSSVPLQ FPRASNDEPI LEFPIIKNDS EEFGFSFGLN  240
MDDGMEFWYD LFIRTGHGGT PELLEF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744710.0DQ074471.1 Malus x domestica MYB23 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009339622.10.0PREDICTED: myb-related protein Myb4-like
RefseqXP_009339621.10.0PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH43e-80MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLQ2LME11e-168Q2LME1_MALDO; MYB23
STRINGPOPTR_0008s16660.14e-99(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.18e-81myb domain protein 15